AMIGO2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: AMIGO2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3 abd may contribute to signal transduction through its intracellular domain. It also may be required for tumorigenesis of a subset of gastric adenocarcinomas.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMIGO2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 2

Protein Size: 522

Purification: Affinity Purified

• Artikelnummer: AVIARP55809_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55809_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 347902
• Wirt: Rabbit