AMN1 Antibody - N-terminal region : Biotin

AMN1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54560_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMN1

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMN1 homolog

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54560_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54560_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 196394
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×