English
AMPH Antibody - N-terminal region : Biotin
AMPH Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55434_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH
Key Reference: Hou,T., (2008) J. Mol. Biol. 376 (4), 1201-1214
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Amphiphysin
Protein Size: 695
Purification: Affinity Purified
Description of Target: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH
Key Reference: Hou,T., (2008) J. Mol. Biol. 376 (4), 1201-1214
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Amphiphysin
Protein Size: 695
Purification: Affinity Purified
| Artikelnummer | AVIARP55434_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55434_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 273 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
