Angel1 Antibody - C-terminal region : FITC

Angel1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55224_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of Angel1 remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein angel homolog 1

Protein Size: 667

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55224_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55224_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 68737
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×