ANGPT4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPT4

Key Reference: Nakayama,T., (2007) World J. Gastroenterol. 13 (33), 4473-4479

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Angiopoietin-4

Protein Size: 503

Purification: Affinity Purified

• Artikelnummer: AVIARP56798_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56798_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51378
• Wirt: Rabbit