English
ANGPTL5 Antibody - N-terminal region : Biotin
ANGPTL5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55766_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The exact functions of ANGPTL5 remain unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 44kDa
Peptide Sequence: Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Angiopoietin-related protein 5
Protein Size: 388
Purification: Affinity Purified
Description of Target: The exact functions of ANGPTL5 remain unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 44kDa
Peptide Sequence: Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Angiopoietin-related protein 5
Protein Size: 388
Purification: Affinity Purified
| Artikelnummer | AVIARP55766_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55766_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 253935 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
