ANKRD13D Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD13D

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 13D

Protein Size: 518

Purification: Affinity Purified

• Artikelnummer: AVIARP55995_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55995_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 338692
• Wirt: Rabbit