ANKRD37 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD37

Key Reference: Li,J., (2005) Cell. Mol. Biol. Lett. 10 (1), 185-193

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 37

Protein Size: 158

Purification: Affinity Purified

• Artikelnummer: AVIARP55804_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55804_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 353322
• Wirt: Rabbit