Anti-BRAP Magnetic Beads

Uniprot: Q7Z569

Gene Name: BRAP

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: MKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKR

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: RNF52

Alternative protein names: BRCA1-associated protein; BRAP2; Impedes mitogenic signal propagation; IMP; RING finger protein 52; RING-type E3 ubiquitin transferase BRAP2; Renal carcinoma antigen NY-REN-63

Protein name: BRCA1 associated protein

Product panel: E3 Ligase

Antigen Species: Human

Target Name: BRAP

IP Dilution: 1:5

Antigen ID: PP-6256

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-073-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-073-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG2a
• Human Gene ID: 8315
• Wirt: Mouse