CloneID: 4F-6
Heavy Chain modification: Fc Silent™
Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
Buffer Composition: PBS with 0.02% Proclin 300.
Concentration: 1 mg/ml
Chimeric Use Statement: This is a reformatted human IgG1 Fc Silent Fc Silent™ antibody, based on the original human IgG1 format, created for improved compatibility with existing reagents, assays and techniques.
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Uniprot Accession No.: P42574