Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG1, kappa, Host: Human
Artikelnummer
ABAAb04219-10.3-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: 4F-6

Heavy Chain modification: Fc Silent™

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Chimeric Use Statement: This is a reformatted human IgG1 Fc Silent Fc Silent™ antibody, based on the original human IgG1 format, created for improved compatibility with existing reagents, assays and techniques.

Uniprot Accession No.: P42574
Mehr Informationen
Artikelnummer ABAAb04219-10.3-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04219-10.3-BT
Green Labware Nein
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Western Blotting, ELISA, Inhibition
Isotyp IgG1
Wirt Human
Produktinformation (PDF) Download
MSDS (PDF) Download