Anti-CUL9 Magnetic Beads

Uniprot: Q8IWT3

Gene Name: CUL9

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: SSSTSRNHSCTPDPEEESKSEASFSEEETESLKAKAEAPKTEAEPTKTRTETPMAQSDSQLFNQLLVTEGMTLPTEMKEAASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLSALSQAVE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Pig - 86%, Cynomolgus monkey - 95%

Alternative gene names: H7AP1; KIAA0708; PARC

Alternative protein names: Cullin-9; CUL-9; UbcH7-associated protein 1; p53-associated parkin-like cytoplasmic protein

Protein name: Cullin 9

Product panel: E3 Ligase

Antigen Species: Human

Target Name: CUL9

IP Dilution: 1:5

Antigen ID: PP-8623

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-077-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-077-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 23113
• Wirt: Mouse