Anti-EZH1

enhancer of zeste 1 polycomb repressive complex 2 subunit, Polyclonal, IgG, Rabbit

GeneName: EZH1

Enhanced Validation: No

Concentration: 0.2

Sequence: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE

Interspecies Mouse/Rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%

Entrez Gene ID: 2145

UniProt ID: Q92800

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000108799

• Artikelnummer: ATLHPA077684-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA077684-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 2145
• Wirt: Rabbit