Anti-IFIT1B

interferon-induced protein with tetratricopeptide repeats 1B, Polyclonal, IgG, Rabbit

GeneName: IFIT1B

Enhanced Validation: No

Concentration: 0.1

Sequence: RFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLNALEKLAKRCIHQNVR

Interspecies Mouse/Rat: ENSMUSG00000079339: 58%, ENSRNOG00000019050: 66%

Entrez Gene ID: 439996

UniProt ID: Q5T764

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000204010

• Artikelnummer: ATLHPA062924-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA062924-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 439996
• Wirt: Rabbit