Anti-NETO1

neuropilin (NRP) and tolloid (TLL)-like 1, Polyclonal, IgG, Rabbit

GeneName: NETO1

Enhanced Validation: No

Concentration: 0.1

Sequence: PIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKD

Interspecies Mouse/Rat: ENSMUSG00000050321: 100%, ENSRNOG00000014006: 100%

Entrez Gene ID: 81832

UniProt ID: Q8TDF5

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000166342

• Artikelnummer: ATLHPA064630-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA064630-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 81832
• Wirt: Rabbit