Anti-OPG (AbAb01OPG)

Anti-OPG [AbAb01OPG], Monoclonal, IgG1, kappa, Host: Mouse
Artikelnummer
ABAAb04113-1.1-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: AbAb01OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: O00300
Mehr Informationen
Artikelnummer ABAAb04113-1.1-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04113-1.1-BT
Green Labware Nein
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode ELISA
Isotyp IgG1
Wirt Mouse
Produktinformation (PDF) Download
MSDS (PDF) Download