Anti-PDRG1

p53 and DNA-damage regulated 1, Polyclonal, IgG, Rabbit

GeneName: PDRG1

Enhanced Validation: No

Concentration: 0.1

Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIV

Interspecies Mouse/Rat: ENSMUSG00000027472: 94%, ENSRNOG00000008845: 87%

Entrez Gene ID: 81572

UniProt ID: Q9NUG6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000088356

• Artikelnummer: ATLHPA063542-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA063542-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 81572
• Wirt: Rabbit