Anti-RGS1

regulator of G protein signaling 1, Polyclonal, IgG, Rabbit

GeneName: RGS1

Enhanced Validation: No

Concentration: 0.05

Sequence: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS

Interspecies Mouse/Rat: ENSRNOG00000003895: 92%, ENSMUSG00000026358: 92%

Entrez Gene ID: 5996

UniProt ID: Q08116

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000090104

• Artikelnummer: ATLHPA074572-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA074572-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 5996
• Wirt: Rabbit