Anti-SUN3

Sad1 and UNC84 domain containing 3, Polyclonal, IgG, Rabbit

GeneName: SUN3

Enhanced Validation: Yes

Concentration: 0.5

Sequence: KLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSG

Interspecies Mouse/Rat: ENSMUSG00000040985: 89%, ENSRNOG00000005105: 89%

Entrez Gene ID: 256979

UniProt ID: Q8TAQ9

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000164744

• Artikelnummer: ATLHPA076890-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA076890-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 256979
• Wirt: Rabbit