Anti-TRIM31 Magnetic Beads

Uniprot: Q9BZY9

Gene Name: TRIM31

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASS

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 52%, Rat - 29%, Pig - 52%, Cynomolgus monkey - 29%

Alternative gene names: C6orf13; RNF

Alternative protein names: E3 ubiquitin-protein ligase TRIM31; Tripartite motif-containing protein 31

Protein name: Tripartite motif containing 31

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM31

IP Dilution: 1:5

Antigen ID: PP-2732

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-071-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-071-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 11074
• Wirt: Mouse