Anti-TRIM47 Magnetic Beads

Uniprot: Q96LD4

Gene Name: TRIM47

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: PAPALAPEPSAPSALPSVPEPSAPCAPEPWPAGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 39%

Alternative gene names: GOA; RNF100

Alternative protein names: E3 ubiquitin-protein ligase TRIM47; Gene overexpressed in astrocytoma protein; RING finger protein 100; Tripartite motif-containing protein 47

Protein name: Tripartite motif containing 47

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM47

IP Dilution: 1:5

Antigen ID: PP-8162

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-053-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-053-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG2a
• Human Gene ID: 91107
• Wirt: Mouse