Anti-TRIM49 Magnetic Beads

Uniprot: P0CI25

Gene Name: TRIM49

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMY

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 32%, Rat - 32%, Pig - 46%, Cynomolgus monkey - 88%

Alternative gene names: RNF18

Alternative protein names: Tripartite motif-containing protein 49; RING finger protein 18; Testis-specific RING-finger protein

Protein name: Tripartite motif containing 49

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM49

IP Dilution: 1:5

Antigen ID: P67967PA

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-054-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-054-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 57093
• Wirt: Mouse