Anti-TRIM54 Magnetic Beads

Uniprot: Q9BYV2

Gene Name: TRIM54

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: LLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGP

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 94%, Cynomolgus monkey - 96%

Alternative gene names: MURF; MURF3; RNF30

Alternative protein names: Tripartite motif-containing protein 54; Muscle-specific RING finger protein; MuRF; Muscle-specific RING finger protein 3; MuRF-3; MuRF3; RING finger protein 30

Protein name: Tripartite motif containing 54

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM54

IP Dilution: 1:5

Antigen ID: PP-8231

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-068-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-068-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 57159
• Wirt: Mouse