Anti-TRIM72 Magnetic Beads

Uniprot: Q6ZMU5

Gene Name: TRIM72

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: FRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 86%, Pig - 91%, Cynomolgus monkey - 61%

Alternative gene names: MG53

Alternative protein names: Tripartite motif-containing protein 72; Mitsugumin-53; Mg53

Protein name: Tripartite motif containing 72

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM72

IP Dilution: 1:5

Antigen ID: PP-4251

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-058-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-058-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 493829
• Wirt: Mouse