Anti-ZBTB45

zinc finger and BTB domain containing 45, Polyclonal, IgG, Rabbit

GeneName: ZBTB45

Enhanced Validation: No

Concentration: 0.05

Sequence: APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH

Interspecies Mouse/Rat: ENSMUSG00000049600: 78%, ENSRNOG00000027459: 80%

Entrez Gene ID: 84878

UniProt ID: Q96K62

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000119574

• Artikelnummer: ATLHPA075485-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA075485-100
• Green Labware: Nein
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 84878
• Wirt: Rabbit