APIP Antibody - N-terminal region : Biotin

APIP Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56788_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 204

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56788_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56788_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51074
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×