APOA2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOA2

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein A-II

Protein Size: 100

Purification: Affinity Purified

• Artikelnummer: AVIARP54588_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54588_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 336
• Wirt: Rabbit