APOBEC4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APOBEC4

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative C->U-editing enzyme APOBEC-4

Protein Size: 367

Purification: Affinity Purified

• Artikelnummer: AVIARP55976_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55976_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 403314
• Wirt: Rabbit