APOL5 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein L5

Protein Size: 433

Purification: Affinity Purified

• Artikelnummer: AVIARP58857_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58857_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 80831
• Wirt: Rabbit
• Konjugat: Conjugated, FITC