ARG2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARG2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arginase-2, mitochondrial

Protein Size: 354

Purification: Affinity Purified

• Artikelnummer: AVIARP54566_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54566_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 384
• Wirt: Rabbit