ARHGAP15 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 15

Protein Size: 475

Purification: Affinity Purified

• Artikelnummer: AVIARP57262_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57262_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55843
• Wirt: Rabbit