ARHGAP20 Antibody - middle region : HRP

ARHGAP20 Antibody - middle region : HRP
Artikelnummer
AVIARP57460_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP20 is an GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP20

Molecular Weight: 132kDa

Peptide Sequence: Synthetic peptide located within the following region: YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 20

Protein Size: 1191

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57460_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57460_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57569
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×