English
ARHGAP25 Antibody - middle region : Biotin
ARHGAP25 Antibody - middle region : Biotin
Artikelnummer
AVIARP58423_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25
Key Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Rho GTPase-activating protein 25
Protein Size: 638
Purification: Affinity Purified
Description of Target: ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25
Key Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Rho GTPase-activating protein 25
Protein Size: 638
Purification: Affinity Purified
| Artikelnummer | AVIARP58423_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58423_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 9938 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
