ARHGAP25 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25

Key Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 25

Protein Size: 638

Purification: Affinity Purified

• Artikelnummer: AVIARP58423_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58423_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9938
• Wirt: Rabbit
• Konjugat: Conjugated, FITC