ARHGAP30 Antibody - N-terminal region : HRP

ARHGAP30 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54462_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP30

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 30

Protein Size: 890

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54462_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54462_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257106
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×