ARHGEF26 Antibody - N-terminal region : FITC

ARHGEF26 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55292_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGEF

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho guanine nucleotide exchange factor 26

Protein Size: 871

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55292_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55292_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26084
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×