ARHGEF26 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGEF

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho guanine nucleotide exchange factor 26

Protein Size: 871

Purification: Affinity Purified

• Artikelnummer: AVIARP55292_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55292_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26084
• Wirt: Rabbit