English
ARHGEF3 Antibody - N-terminal region : Biotin
ARHGEF3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57339_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHG3
Key Reference: N/A
Molecular Weight: 57kDa
Peptide Sequence: Synthetic peptide located within the following region: VKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: rho guanine nucleotide exchange factor 3
Protein Size: 526
Purification: Affinity purified
Description of Target: Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHG3
Key Reference: N/A
Molecular Weight: 57kDa
Peptide Sequence: Synthetic peptide located within the following region: VKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: rho guanine nucleotide exchange factor 3
Protein Size: 526
Purification: Affinity purified
| Artikelnummer | AVIARP57339_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57339_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 50650 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
