ARIH2 Antibody - N-terminal region : Biotin

ARIH2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57935_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ARIH2 is the E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. 'ARIH2 may play a role in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARIH2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase ARIH2

Protein Size: 493

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57935_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57935_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10425
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×