ARSA Antibody - middle region : HRP

ARSA Antibody - middle region : HRP
Artikelnummer
AVIARP54529_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARSA

Key Reference: Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arylsulfatase A

Protein Size: 507

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54529_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54529_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 410
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×