English
ARSA Antibody - N-terminal region : Biotin
ARSA Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54528_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARSA
Key Reference: Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425
Molecular Weight: 56kDa
Peptide Sequence: Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Arylsulfatase A
Protein Size: 507
Purification: Affinity Purified
Description of Target: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARSA
Key Reference: Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425
Molecular Weight: 56kDa
Peptide Sequence: Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Arylsulfatase A
Protein Size: 507
Purification: Affinity Purified
| Artikelnummer | AVIARP54528_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54528_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 410 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
