Arsg Antibody - C-terminal region : HRP

Arsg Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55122_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Arsg displays arylsulfatase activity with pseudosubstrates at acidic pH, such as p-nitrocatechol sulfate.

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: GRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITGGA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arylsulfatase G

Protein Size: 525

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55122_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55122_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 74008
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×