ASH2L Antibody - N-terminal region : HRP

ASH2L Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58133_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. It as part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. It may function as a transcriptional regulator. And it May play a role in hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASH2L

Key Reference: N/A

Molecular Weight: 69 kDa

Peptide Sequence: Synthetic peptide located within the following region: GPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Set1/Ash2 histone methyltransferase complex subunit ASH2

Protein Size: 628

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58133_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58133_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9070
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×