ASXL2 Antibody - middle region : HRP

ASXL2 Antibody - middle region : HRP
Artikelnummer
AVIARP57184_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASXL2

Molecular Weight: 154kDa

Peptide Sequence: Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative Polycomb group protein ASXL2

Protein Size: 1435

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57184_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57184_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55252
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×