ATG10 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATG10

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: FFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-like-conjugating enzyme ATG10

Protein Size: 220

Purification: Affinity Purified

• Artikelnummer: AVIARP59065_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59065_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83734
• Wirt: Rabbit
• Konjugat: Conjugated, HRP