Atg12 Antibody - C-terminal region : HRP

Atg12 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP59030_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Atg12 is the ubiquitin-like protein required for autophagy. NP_001033584 is conjugated to ATG3 and ATG5.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-like protein ATG12

Protein Size: 141

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59030_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59030_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 361321
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×