ATG16L1 Antibody - middle region : Biotin

ATG16L1 Antibody - middle region : Biotin
Artikelnummer
AVIARP59066_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L1

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Autophagy-related protein 16-1

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59066_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59066_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55054
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×