ATG16L1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: EYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein FLJ10035 EMBL AAY14860.1

Protein Size: 523

Purification: Affinity Purified

• Artikelnummer: AVIARP58924_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58924_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55054
• Wirt: Rabbit
• Konjugat: Conjugated, FITC