ATG16L2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ATG16L2 may play a role in autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: SASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 513

Purification: Affinity Purified

• Artikelnummer: AVIARP59067_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59067_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 89849
• Wirt: Rabbit
• Konjugat: Conjugated, HRP