ATG3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG3

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like-conjugating enzyme ATG3

Protein Size: 314

Purification: Affinity Purified

• Artikelnummer: AVIARP59069_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59069_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64422
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin